QARS monoclonal antibody (M01), clone 5F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant QARS.
Immunogen
QARS (NP_005042, 677 a.a. ~ 775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
QARS monoclonal antibody (M01), clone 5F5 Western Blot analysis of QARS expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody (M01), clone 5F5.
Lane 1: QARS transfected lysate(87.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of QARS transfected lysate using anti-QARS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with QARS MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged QARS is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — QARS
Entrez GeneID
5859GeneBank Accession#
NM_005051Protein Accession#
NP_005042Gene Name
QARS
Gene Alias
GLNRS, PRO2195
Gene Description
glutaminyl-tRNA synthetase
Omim ID
603727Gene Ontology
HyperlinkGene Summary
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family. [provided by RefSeq
Other Designations
glutamine tRNA ligase|glutamine-tRNA synthetase
-
Interactome
-
Pathway
-
Publication Reference
-
Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L.
Neoplasia 2009 Nov; 11(11):1194.
Application:WB-Ce, Human, MCF-7, MDA-MB-231, T-47D cells.
-
Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com