PXMP3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PXMP3 polyclonal antibody (A01), Lot # 051031JC01 Western Blot analysis of PXMP3 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
PXMP3 polyclonal antibody (A01), Lot # 051031JC01. Western Blot analysis of PXMP3 expression in NIH/3T3.
Western Blot detection against Immunogen (35.9 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PXMP3.
Immunogen
PXMP3 (NP_000309, 217 a.a. ~ 305 a.a) partial recombinant protein with GST tag.
Sequence
KAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.9 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PXMP3 polyclonal antibody (A01), Lot # 051031JC01 Western Blot analysis of PXMP3 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
PXMP3 polyclonal antibody (A01), Lot # 051031JC01. Western Blot analysis of PXMP3 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — PXMP3
Entrez GeneID
5828GeneBank Accession#
NM_000318Protein Accession#
NP_000309Gene Name
PXMP3
Gene Alias
PAF-1, PAF1, PEX2, PMP3, PMP35, RNF72
Gene Description
peroxisomal membrane protein 3, 35kDa
Gene Ontology
HyperlinkGene Summary
This gene encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
RING finger protein 72|peroxin 2|peroxin-2|peroxisome assembly factor-1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com