PEX19 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PEX19 protein.
Immunogen
PEX19 (NP_002848.1, 1 a.a. ~ 299 a.a) full-length human protein.
Sequence
MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PEX19 MaxPab polyclonal antibody. Western Blot analysis of PEX19 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of PEX19 expression in transfected 293T cell line (H00005824-T03) by PEX19 MaxPab polyclonal antibody.
Lane 1: PEX19 transfected lysate(32.89 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PEX19
Entrez GeneID
5824GeneBank Accession#
NM_002857.2Protein Accession#
NP_002848.1Gene Name
PEX19
Gene Alias
D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1
Gene Description
peroxisomal biogenesis factor 19
Gene Ontology
HyperlinkGene Summary
This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). [provided by RefSeq
Other Designations
OTTHUMP00000031848|housekeeping gene, 33kD|peroxisomal farnesylated protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com