PTPRS monoclonal antibody (M01), clone 1H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PTPRS.
Immunogen
PTPRS (AAH29496, 31 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTPRS is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PTPRS
Entrez GeneID
5802GeneBank Accession#
BC029496Protein Accession#
AAH29496Gene Name
PTPRS
Gene Alias
PTPSIGMA
Gene Description
protein tyrosine phosphatase, receptor type, S
Omim ID
601576Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this protein is composed of multiple Ig-like and fibronectin type III-like domains. Studies of the similar gene in mice suggested that this PTP may be involved in cell-cell interaction, primary axonogenesis, and axon guidance during embryogenesis. This PTP has been also implicated in the molecular control of adult nerve repair. Four alternatively spliced transcript variants, which encode distinct proteins, have been reported. [provided by RefSeq
Other Designations
protein tyrosine phosphatase PTPsigma|protein tyrosine phosphatase, receptor type, sigma
-
Interactome
-
Disease
-
Publication Reference
-
Synoviocyte-targeted therapy synergizes with TNF inhibition in arthritis reversal.
Mattias N D Svensson, Martina Zoccheddu, Shen Yang, Gyrid Nygaard, Christian Secchi, Karen M Doody, Kamil Slowikowski, Fumitaka Mizoguchi, Frances Humby, Rebecca Hands, Eugenio Santelli, Cristiano Sacchetti, Kuninobu Wakabayashi, Dennis J Wu, Christopher Barback, Rizi Ai, Wei Wang, Gary P Sims, Piotr Mydel, Tsuyoshi Kasama, David L Boyle, Francesco Galimi, David Vera, Michel L Tremblay, Soumya Raychaudhuri, Michael B Brenner, Gary S Firestein, Costantino Pitzalis, Anna-Karin H Ekwall, Stephanie.
Science Advances 2020 Jun; 6(26):eaba4353.
Application:IF, Human, RA synovial tissue.
-
Identification of function-regulating antibodies targeting the receptor protein tyrosine phosphatase sigma ectodomain.
Wu CL, Hardy S, Aubry I, Landry M, Haggarty A, Saragovi HU, Tremblay ML.
PLoS One 2017 May; 12(5):e0178489.
Application:WB-Tr, Human, HEK 293T cells.
-
Synoviocyte-targeted therapy synergizes with TNF inhibition in arthritis reversal.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com