PSMC6 monoclonal antibody (M02), clone 2C4

Catalog # H00005706-M02

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in PC-12(Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

PSMC6 monoclonal antibody (M02), clone 2C4 Western Blot analysis of PSMC6 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in NIH/3T3(Cat # L018V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody (M02), clone 2C4.

Lane 1: PSMC6 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi ( Cat # H00005706-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMC6 monoclonal antibody (M02), clone 2C4 (Cat # H00005706-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10 ug/ml]

QC Test

Western Blot detection against Immunogen (36.74 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant PSMC6.

    Immunogen

    PSMC6 (AAH05390, 290 a.a. ~ 389 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.74 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in PC-12(Cat # L012V1 ).

    Western Blot (Cell lysate)

    PSMC6 monoclonal antibody (M02), clone 2C4 Western Blot analysis of PSMC6 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Cell lysate)

    PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in NIH/3T3(Cat # L018V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody (M02), clone 2C4.

    Lane 1: PSMC6 transfected lysate(44.2 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi ( Cat # H00005706-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMC6 monoclonal antibody (M02), clone 2C4 (Cat # H00005706-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10 ug/ml]
  • Gene Info — PSMC6

    Entrez GeneID

    5706

    GeneBank Accession#

    BC005390

    Protein Accession#

    AAH05390

    Gene Name

    PSMC6

    Gene Alias

    CADP44, MGC12520, P44, SUG2, p42

    Gene Description

    proteasome (prosome, macropain) 26S subunit, ATPase, 6

    Omim ID

    602708

    Gene Ontology

    Hyperlink

    Gene Summary

    The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq

    Other Designations

    26S protease regulatory subunit S10B|conserved ATPase domain protein 44|proteasome 26S ATPase subunit 6|proteasome subunit p42

  • Interactome
  • Pathway
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All