PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00005696-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

PSMB8 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in human kidney.

Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

PSMB8 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in mouse liver.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of PSMB8 expression in transfected 293T cell line (H00005696-T01) by PSMB8 MaxPab polyclonal antibody.

Lane 1: PSMB8 transfected lysate(29.80 KDa).
Lane 2: Non-transfected lysate.

  • Specifications

    Product Description

    Rabbit polyclonal antibody raised against a full-length human PSMB8 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    PSMB8 (NP_004150.1, 1 a.a. ~ 272 a.a) full-length human protein.

    Sequence

    MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

    Host

    Rabbit

    Reactivity

    Human, Mouse

    Interspecies Antigen Sequence

    Mouse (90); Rat (90)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    PSMB8 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in human kidney.

    Western Blot (Tissue lysate)

    PSMB8 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in mouse liver.

    Western Blot (Transfected lysate)

    Western Blot analysis of PSMB8 expression in transfected 293T cell line (H00005696-T01) by PSMB8 MaxPab polyclonal antibody.

    Lane 1: PSMB8 transfected lysate(29.80 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — PSMB8

    Entrez GeneID

    5696

    GeneBank Accession#

    NM_004159

    Protein Accession#

    NP_004150.1

    Gene Name

    PSMB8

    Gene Alias

    D6S216, D6S216E, LMP7, MGC1491, PSMB5i, RING10, beta5i

    Gene Description

    proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)

    Omim ID

    177046

    Gene Ontology

    Hyperlink

    Gene Summary

    The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq

    Other Designations

    OTTHUMP00000029420|OTTHUMP00000029421|OTTHUMP00000062981|low molecular weight protein 7|macropain subunit C13|multicatalytic endopeptidase complex subunit C13|protease component C13|proteasome (prosome, macropain) subunit beta type 8 (large multifunctiona

  • Interactomes
  • Pathways
  • Diseases
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All