FXYD3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FXYD3 protein.
Immunogen
FXYD3 (AAH05238, 21 a.a. ~ 87 a.a) full-length human protein.
Sequence
NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FXYD3 expression in transfected 293T cell line (H00005349-T01) by FXYD3 MaxPab polyclonal antibody.
Lane 1: FXYD3 transfected lysate(9.68 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FXYD3
Entrez GeneID
5349GeneBank Accession#
BC005238Protein Accession#
AAH05238Gene Name
FXYD3
Gene Alias
MAT-8, MAT8, MGC111076, PLML
Gene Description
FXYD domain containing ion transport regulator 3
Omim ID
604996Gene Ontology
HyperlinkGene Summary
This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Other Designations
FXYD domain-containing ion transport regulator 3|mammary tumor 8 kDa protein|phospholemman-like protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com