SLC26A4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SLC26A4.
Immunogen
SLC26A4 (NP_000432, 674 a.a. ~ 754 a.a) partial recombinant protein with GST tag.
Sequence
RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.02 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SLC26A4
Entrez GeneID
5172GeneBank Accession#
NM_000441Protein Accession#
NP_000432Gene Name
SLC26A4
Gene Alias
DFNB4, EVA, PDS
Gene Description
solute carrier family 26, member 4
Gene Ontology
HyperlinkGene Summary
Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq
Other Designations
pendrin
-
Interactome
-
Disease
-
Publication Reference
-
Inflammatory cytokines TNFα and IL-17 enhance the efficacy of cystic fibrosis transmembrane conductance regulator modulators.
Tayyab Rehman, Philip H Karp, Ping Tan, Brian J Goodell, Alejandro A Pezzulo, Andrew L Thurman, Ian M Thornell, Samantha L Durfey, Michael E Duffey, David A Stoltz, Edward F McKone, Pradeep K Singh, Michael J Welsh.
The Journal of Clinical Investigation 2021 Aug; 131(16):e150398.
Application:IF, Human, Human airway epithelia.
-
TNFα and IL-17 Alkalinize Airway Surface Liquid Through CFTR and Pendrin.
Tayyab Rehman, Ian M Thornell, Alejandro A Pezzulo, Andrew L Thurman, Guillermo S Romano Ibarra, Philip H Karp, Ping Tan, Michael E Duffey, Michael J Welsh.
American Journal of Physiology. Cell Physiology 2020 Aug; 319(2):C331.
Application:IHC, Human, Airway epithelia.
-
FOXI1 Immunohistochemistry Differentiates Benign Renal Oncocytoma from Malignant Chromophobe Renal Cell Carcinoma.
Molnar A, Horvath CA, Czovek P, Szanto A, Kovacs G.
Anticancer Research 2019 Jun; 39(6):2785.
Application:IHC-P, Human, Human renal cell carcinoma.
-
Developmental expression of solute carrier family 26A member 4 (SLC26A4/pendrin) during amelogenesis in developing rodent teeth.
Bronckers AL, Guo J, Zandieh-Doulabi B, Bervoets TJ, Lyaruu DM, Li X, Wangemann P, DenBesten P.
European Journal of Oral Sciences 2011 Dec; Suppl 1:185.
Application:IHC-P, Mouse, Rat, Kidney, Teeth.
-
Novel Role for Pendrin in Orchestrating Bicarbonate Secretion in Cystic Fibrosis Transmembrane Conductance Regulator (CFTR)-expressing Airway Serous Cells.
Garnett JP, Hickman E, Burrows R, Hegyi P, Tiszlavicz L, Cuthbert AW, Fong P, Gray MA.
The Journal of Biological Chemistry 2011 Nov; 286(47):41069.
Application:IF, IHC, Human, Calu-3 cells, Lung, Thyroid.
-
Inflammatory cytokines TNFα and IL-17 enhance the efficacy of cystic fibrosis transmembrane conductance regulator modulators.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com