PAK2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PAK2 partial ORF ( NP_002568, 131 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PAK2
Entrez GeneID
5062GeneBank Accession#
NM_002577Protein Accession#
NP_002568Gene Name
PAK2
Gene Alias
PAK65, PAKgamma
Gene Description
p21 protein (Cdc42/Rac)-activated kinase 2
Omim ID
605022Gene Ontology
HyperlinkGene Summary
The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq
Other Designations
S6/H4 kinase|p21 (CDKN1A)-activated kinase 2|p21-activated kinase 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification and validation of new autoantibodies for the diagnosis of DCIS and node negative early-stage breast cancers.
Lacombe J, Mangé A, Jarlier M, Bascoul-Mollevi C, Rouanet P, Lamy PJ, Maudelonde T, Solassol J.
International Journal of Cancer 2013 Mar; 132(5):1105.
Application：ELISA, Human, Serum.
-
Identification and validation of new autoantibodies for the diagnosis of DCIS and node negative early-stage breast cancers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com