P2RY1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human P2RY1 partial ORF ( NP_002554, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.46
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — P2RY1
Entrez GeneID
5028GeneBank Accession#
NM_002563Protein Accession#
NP_002554Gene Name
P2RY1
Gene Alias
P2Y1
Gene Description
purinergic receptor P2Y, G-protein coupled, 1
Omim ID
601167Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq
Other Designations
ATP receptor|P2 purinoceptor subtype Y1|P2Y purinoceptor 1|platelet ADP receptor|purinergic receptor P2Y1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Involvement of peripheral P2Y1 receptors and potential interaction with IL-1 receptors in IL-1β-induced thermal hypersensitivity in rats.
Kwon SG, Roh DH, Yoon SY, Choi SR, Choi HS, Moon JY, Kang SY, Beitz AJ, Lee JH.
Brain Research Bulletin 2017 Jan; 130:165.
Application:IHC, Rat, Rat dorsal root ganglions.
-
Involvement of peripheral P2Y1 receptors and potential interaction with IL-1 receptors in IL-1β-induced thermal hypersensitivity in rats.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com