NPPB monoclonal antibody (M01), clone 2D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody (M01), clone 2D11.
Lane 1: NPPB transfected lysate(14.726 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of NPPB transfected lysate using anti-NPPB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NPPB MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (40.48 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NPPB.
Immunogen
NPPB (AAH25785, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDSETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Host
Mouse
Reactivity
Human
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody (M01), clone 2D11.
Lane 1: NPPB transfected lysate(14.726 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of NPPB transfected lysate using anti-NPPB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NPPB MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — NPPB
Entrez GeneID
4879GeneBank Accession#
BC025785Protein Accession#
AAH25785Gene Name
NPPB
Gene Alias
BNP
Gene Description
natriuretic peptide precursor B
Omim ID
600295Gene Ontology
HyperlinkGene Summary
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq
Other Designations
OTTHUMP00000002506|OTTHUMP00000044486|brain type natriuretic peptide|natriuretic protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The arrhythmogenic effect of self-assembling nanopeptide hydrogel scaffolds on neonatal mouse cardiomyocytes.
Chiu YW, Chen WP, Su CC, Lee YC, Hsieh PH, Ho YL.
Nanomedicine 2014 Jul; 10(5):1065.
Application：ELISA, Mouse, Primary neonatal mouse heart cell culture medium.
-
The arrhythmogenic effect of self-assembling nanopeptide hydrogel scaffolds on neonatal mouse cardiomyocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com