NME2 monoclonal antibody (M01), clone 4B7-3F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NME2.
Immunogen
NME2 (AAH02476, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.46 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NME2 monoclonal antibody (M01), clone 4B7-3F12 Western Blot analysis of NME2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NME2 expression in transfected 293T cell line by NME2 monoclonal antibody (M01), clone 4B7-3F12.
Lane 1: NME2 transfected lysate(17.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NME2 over-expressed 293 cell line, cotransfected with NME2 Validated Chimera RNAi ( Cat # H00004831-R11V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NME2 monoclonal antibody (M01), clone 4B7-3F12 (Cat # H00004831-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NME2
Entrez GeneID
4831GeneBank Accession#
BC002476Protein Accession#
AAH02476Gene Name
NME2
Gene Alias
MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf
Gene Description
non-metastatic cells 2, protein (NM23B) expressed in
Omim ID
156491Gene Ontology
HyperlinkGene Summary
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations
NDP kinase B|OTTHUMP00000174727|OTTHUMP00000174728|OTTHUMP00000174774|OTTHUMP00000174775|OTTHUMP00000174776|c-myc transcription factor|non-metastatic cells 2, protein (NM23) expressed in
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com