NDUFS4 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NDUFS4 protein.
Immunogen
NDUFS4 (NP_002486.1, 1 a.a. ~ 175 a.a) full-length human protein.
Sequence
MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NDUFS4 expression in transfected 293T cell line (H00004724-T01) by NDUFS4 MaxPab polyclonal antibody.
Lane 1: NDUFS4 transfected lysate(19.25 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NDUFS4
Entrez GeneID
4724GeneBank Accession#
NM_002495.1Protein Accession#
NP_002486.1Gene Name
NDUFS4
Gene Alias
AQDQ
Gene Description
NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Gene Ontology
HyperlinkGene Summary
This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) Fe-S protein 4|NADH dehydrogenase (ubiquinone) iron-sulfur protein 4|NADH-coenzyme Q reductase, 18-KD|NADH-ubiquinone oxidoreductase 18 kDa subunit|mitochondrial respiratory chain complex I (18-KD subunit)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com