MTNR1A polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant MTNR1A.
Immunogen
MTNR1A (NP_005949, 296 a.a. ~ 350 a.a) partial recombinant protein with GST tag.
Sequence
GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (80)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.16 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MTNR1A
Entrez GeneID
4543GeneBank Accession#
NM_005958Protein Accession#
NP_005949Gene Name
MTNR1A
Gene Alias
MEL-1A-R, MT1
Gene Description
melatonin receptor 1A
Omim ID
600665Gene Ontology
HyperlinkGene Summary
This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq
Other Designations
melatonin receptor type 1A
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Melatonin Membrane Receptors MT 1 and MT 2 Are Expressed in Ram Spermatozoa From Non-Seasonal Breeds.
Melissa Carvajal-Serna, Eliana Neira-Rivera, Jaime Antonio Cardozo, Henry Grajales-Lombana, José Álvaro Cebrián-Pérez, Teresa Muiño-Blanco, Rosaura Pérez-Pé, Adriana Casao.
Tropical Animal Health and Production 2020 Sep; 52(5):2549.
Application:IF, Donkey, Spermatozoa.
-
Melatonin MT1 and MT2 Receptors in the Ram Reproductive Tract.
González-Arto M, Aguilar D, Gaspar-Torrubia E, Gallego M, Carvajal-Serna M, Herrera-Marcos LV, Serrano-Blesa E, Hamilton TR, Pérez-Pé R, Muiño-Blanco T, Cebrián-Pérez JA, Casao A.
International Journal of Molecular Sciences 2017 Mar; 18(3):E662.
Application:IF, Rasa Aragonesa rams, Spermatozoa from Rasa Aragonesa rams.
-
Melatonin Receptors MT1 and MT2 are Expresed in Spermatozoa from Several Seasonal and Non-Seasonal Breeder Species.
Gonzalez-Arto M, Vicente-Carrillo A, Martinez-Pastor F, Fernandez-Alegre E, Roca J, Miro J, Rigau T, Rodriguez-Gil JE, Perez-Pe R, Muino-Blanco T, Cebrian-Perez JA, Casao A.
Theriogenology 2016 Nov; 86(8):1958.
Application:IF, Dog, Pig, Deer, Bovine, Spermatozoa.
-
Identification and immunolocalisation of melatonin MT(1) and MT(2) receptors in Rasa Aragonesa ram spermatozoa.
Casao A, Gallego M, Abecia JA, Forcada F, Pérez-Pé R, Muiño-Blanco T, Cebrián-Pérez JÁ.
Reproduction, Fertility, and Development 2012 Mar; 24(7):953.
Application:IF, Sheep, Sheep sperm.
-
Expression and cellular localizaion of melatonin-synthesizing enzymes in rat and human salivary glands.
Shimozuma M, Tokuyama R, Tatehara S, Umeki H, Ide S, Mishima K, Saito I, Satomura K.
Histochemistry and Cell Biology 2011 Apr; 135(4):389.
Application:IHC, Rat, Buccal mucosa, Salivary glands.
-
Melatonin Membrane Receptors MT 1 and MT 2 Are Expressed in Ram Spermatozoa From Non-Seasonal Breeds.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com