CITED1 monoclonal antibody (M03J), clone 5H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CITED1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (77)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CITED1 monoclonal antibody (M03J), clone 5H6. Western Blot analysis of CITED1 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03J), clone 5H6.
Lane 1: CITED1 transfected lysate (Predicted MW: 19.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CITED1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CITED1
Entrez GeneID
4435GeneBank Accession#
NM_004143Protein Accession#
NP_004134Gene Name
CITED1
Gene Alias
MSG1
Gene Description
Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Omim ID
300149Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
Cbp/p300-interacting transactivator 1|OTTHUMP00000023529|OTTHUMP00000023530
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com