MPG monoclonal antibody (M04), clone 1E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MPG.
Immunogen
MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MPG monoclonal antibody (M04), clone 1E10 Western Blot analysis of MPG expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of MPG expression in transfected 293T cell line by MPG monoclonal antibody (M04), clone 1E10.
Lane 1: MPG transfected lysate(32.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MPG is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MPG on HeLa cell. [antibody concentration 40 ug/ml] -
Gene Info — MPG
Entrez GeneID
4350GeneBank Accession#
BC014991Protein Accession#
AAH14991Gene Name
MPG
Gene Alias
AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg
Gene Description
N-methylpurine-DNA glycosylase
Omim ID
156565Gene Ontology
HyperlinkGene Summary
localized 68 kb upstream the humanzeta globin gene on 16p|CRA36.1 (3-methyl-adenine DNA glycosylase)|N-methylpurine-DNA glycosylase
Other Designations
3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on 16p|CRA36.1 (3-methyl-adenine DNA glycosylase)|N-methylpurine-DNA glycosylase, MPG|alkyladenine DNA glycosylase|proliferation-inducing protein 11|proliferation-inducing protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair.
Chou WC, Wang HC, Wong FH, Ding SL, Wu PE, Shieh SY, Shen CY.
The EMBO Journal 2008 Dec; 27(23):3140.
Application:WB, Human, 293T cells.
-
Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com