CD99 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD99 full-length ORF ( NP_002405.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.2
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CD99
Entrez GeneID
4267GeneBank Accession#
NM_002414.3Protein Accession#
NP_002405.1Gene Name
CD99
Gene Alias
MIC2, MIC2X, MIC2Y
Gene Description
CD99 molecule
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. Cyclophilin A binds to CD99 and may act as a signaling regulator of CD99. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD99 antigen|E2 antigen|MIC2 (monoclonal antibody 12E7)|OTTHUMP00000022840|T-cell surface glycoprotein E2|antigen identified by monoclonal 12E7, Y homolog|antigen identified by monoclonal antibodies 12E7, F21 and O13|surface antigen MIC2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Diapedesis-Induced Integrin Signaling via LFA-1 Facilitates Tissue Immunity by Inducing Intrinsic Complement C3 Expression in Immune Cells.
Martin Kolev, Erin E West, Natalia Kunz, Daniel Chauss, E Ashley Moseman, Jubayer Rahman, Tilo Freiwald, Maria L Balmer, Jonas Lötscher, Sarah Dimeloe, Elizabeth C Rosser, Lucy R Wedderburn, Katrin D Mayer-Barber, Andrea Bohrer, Paul Lavender, Andrew Cope, Luopin Wang, Mariana J Kaplan, Niki M Moutsopoulo, Dorian McGavern, Steven M Holland, Christoph Hess, Majid Kazemian, Behdad Afzali, Claudia Kemper.
Immunity 2020 Mar; 52(3):513.
Application:Sub, Human, Human CD4+ T cells.
-
Diapedesis-Induced Integrin Signaling via LFA-1 Facilitates Tissue Immunity by Inducing Intrinsic Complement C3 Expression in Immune Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com