MDH1 monoclonal antibody (M01), clone 2B11-B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MDH1.
Immunogen
MDH1 (AAH01484.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MDH1 monoclonal antibody (M01), clone 2B11-B7. Western Blot analysis of MDH1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Cell lysate)
MDH1 monoclonal antibody (M01), clone 2B11-B7. Western Blot analysis of MDH1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
MDH1 monoclonal antibody (M01), clone 2B11-B7. Western Blot analysis of MDH1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MDH1 expression in transfected 293T cell line by MDH1 monoclonal antibody (M01), clone 2B11-B7.
Lane 1: MDH1 transfected lysate(36.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MDH1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — MDH1
Entrez GeneID
4190GeneBank Accession#
BC001484Protein Accession#
AAH01484.1Gene Name
MDH1
Gene Alias
MDH-s, MDHA, MGC:1375, MOR2
Gene Description
malate dehydrogenase 1, NAD (soluble)
Omim ID
154200Gene Ontology
HyperlinkGene Summary
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq
Other Designations
cytosolic malate dehydrogenase|soluble malate dehydrogenase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Citrate cycle (TCA cycle)
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com