LGALS9 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LGALS9.
Immunogen
LGALS9 (NP_033665, 254 a.a. ~ 355 a.a) partial recombinant protein with GST tag.
Sequence
FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.33 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LGALS9 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of LGALS9 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — LGALS9
Entrez GeneID
3965GeneBank Accession#
NM_009587Protein Accession#
NP_033665Gene Name
LGALS9
Gene Alias
HUAT, LGALS9A, MGC117375, MGC125973, MGC125974
Gene Description
lectin, galactoside-binding, soluble, 9
Omim ID
601879Gene Ontology
HyperlinkGene Summary
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
ecalectin|galectin 9|galectin-9|urate transporter/channel protein
-
Interactome
-
Publication Reference
-
Structural features of galectin-9 and galectin-1 that determine distinct T cell death pathways.
Bi S, Earl LA, Jacobs L, Baum LG.
The Journal of Biological Chemistry 2008 Feb; 283(18):12248.
Application:IF, IHC, Human, Human thymus.
-
Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis.
Bellac CL, Coimbra RS, Simon F, Imboden H, Leib SL.
Neurobiology of Disease 2007 Jul; 28(2):175.
Application:IF, WB-Ti, Rat, Rat brain.
-
Structural features of galectin-9 and galectin-1 that determine distinct T cell death pathways.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com