LAMP2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LAMP2 partial ORF ( NP_054701, 30 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LAMP2
Entrez GeneID
3920GeneBank Accession#
NM_013995Protein Accession#
NP_054701Gene Name
LAMP2
Gene Alias
CD107b, LAMPB, LGP110
Gene Description
lysosomal-associated membrane protein 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq
Other Designations
OTTHUMP00000023943|OTTHUMP00000023944|lysosome-associated membrane protein 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
EBV Antibodies Mark SLE and Scleroderma Patients Negative for Anti-DNA.
Fattal I, Shental N, Molad Y, Gabrielli A, Pokroy-Shapira E, Oren S, Livneh A, Langevitz P, Pauzner R, Sarig O, Gafter U, Domany E, Cohen IR.
Immunology 2014 Feb; 141(2):276.
Application:Antigen microarray, Human, Serum.
-
Anti-LAMP-2 antibodies are not prevalent in patients with antineutrophil cytoplasmic autoantibody glomerulonephritis.
Roth AJ, Brown MC, Smith RN, Badhwar AK, Parente O, Chung Hc, Bunch DO, McGregor JG, Hogan SL, Hu Y, Yang JJ, Berg EA, Niles J, Jennette JC, Preston GA, Falk RJ.
Journal of the American Society of Nephrology 2012 Mar; 23(3):545.
Application:ELISA, WB-Re, Human, HEK cells, Serum.
-
EBV Antibodies Mark SLE and Scleroderma Patients Negative for Anti-DNA.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com