LAMC1 DNAxPab

Catalog # H00003915-W01P

Size

Price

Stock

Quantity

Size:200 ug
Price: USD $ 620.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human LAMC1 DNA using DNAx™ Immune technology.DNAx Polyclonal Antibody,DNAx Polyclonal Antibodies,DNAx Pab,DNAx Polyclonal,DNA Immune,DNA Immunization,Immune Technology,Hard-to-Find Antibody,Hard-to-Find Antibodies,Hard-to-Find,Hard to Find,HardtoFind

    Technology

    DNAx™ Immune

    Immunogen

    Full-length human DNA

    Sequence

    MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS

    Host

    Rabbit

    Reactivity

    Human

    Purification

    Protein A

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Immunofluorescence (Transfected cell)

    Flow Cytometry (Transfected cell)

  • Gene Info — LAMC1

    Entrez GeneID

    3915

    GeneBank Accession#

    BC015586

    Protein Accession#

    AAH15586

    Gene Name

    LAMC1

    Gene Alias

    LAMB2, MGC87297

    Gene Description

    laminin, gamma 1 (formerly LAMB2)

    Omim ID

    150290 176780

    Gene Ontology

    Hyperlink

    Gene Summary

    Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis. [provided by RefSeq

    Other Designations

    OTTHUMP00000033450|formerly LAMB2|laminin, gamma 1

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All