ITPKB monoclonal antibody (M01), clone 2F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ITPKB monoclonal antibody (M01), clone 2F8 Western Blot analysis of ITPKB expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ITPKB expression in transfected 293T cell line by ITPKB monoclonal antibody (M01), clone 2F8.
Lane 1: ITPKB transfected lysate(67.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITPKB is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITPKB.
Immunogen
ITPKB (NP_002212, 545 a.a. ~ 643 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPR
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ITPKB monoclonal antibody (M01), clone 2F8 Western Blot analysis of ITPKB expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ITPKB expression in transfected 293T cell line by ITPKB monoclonal antibody (M01), clone 2F8.
Lane 1: ITPKB transfected lysate(67.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITPKB is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ITPKB
Entrez GeneID
3707GeneBank Accession#
NM_002221Protein Accession#
NP_002212Gene Name
ITPKB
Gene Alias
IP3K, IP3K-B, IP3KB, PIG37
Gene Description
inositol 1,4,5-trisphosphate 3-kinase B
Omim ID
147522Gene Ontology
HyperlinkGene Summary
The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq
Other Designations
1D-myo-inositol-trisphosphate 3-kinase B|IP3 3-kinase|OTTHUMP00000035705|proliferation-inducing protein 37
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Human inositol-1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope.
Nalaskowski MM, Fliegert R, Ernst O, Brehm MA, Fanick W, Windhorst S, Lin H, Giehler S, Hein J, Lin YN, Mayr GW.
The Journal of Biological Chemistry 2011 Feb; 286(6):4500.
Application：IF, WB, Human, Mewo cells.
-
Human inositol-1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com