ITM1 monoclonal antibody (M02), clone 4D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.
Lane 1: ITM1 transfected lysate(80.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITM1.
Immunogen
ITM1 (NP_689926, 603 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.
Lane 1: ITM1 transfected lysate(80.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — STT3A
Entrez GeneID
3703GeneBank Accession#
NM_152713Protein Accession#
NP_689926Gene Name
STT3A
Gene Alias
FLJ27038, ITM1, MGC9042, STT3-A, TMC
Gene Description
STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae)
Omim ID
601134Gene Ontology
HyperlinkGene Summary
subunit of the oligosaccharyltransferase complex
Other Designations
integral membrane protein 1|integral transmembrane protein 1|transmembrane conserved
-
Interactome
-
Disease
-
Publication Reference
-
Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.
Cherepanova NA, Shrimal S, Gilmore R.
The Journal of Cell Biology 2014 Aug; 206(4):525.
Application：IP, Human, HeLa cells.
-
Keratinocyte-associated protein 2 is a bona fide subunit of the mammalian oligosaccharyltransferase.
Roboti P, High S.
Journal of Cell Science 2012 Jan; 125(Pt1):220.
Application：WB-Ce, Human, HeLa.
-
Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com