ITGB2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ITGB2 partial ORF ( AAH05861, 600 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ITGB2
Entrez GeneID
3689GeneBank Accession#
BC005861Protein Accession#
AAH05861Gene Name
ITGB2
Gene Alias
CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Gene Description
integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
CD18 subunit|OTTHUMP00000115278|OTTHUMP00000115279|OTTHUMP00000115281|OTTHUMP00000115282|beta 2 integrin subunit|cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor)|complement receptor C3 beta-subunit|integrin beta 2|integrin bet
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com