INHA polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant INHA.
Immunogen
INHA (AAH06391, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
Sequence
TPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (80)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — INHA
Entrez GeneID
3623GeneBank Accession#
BC006391Protein Accession#
AAH06391Gene Name
INHA
Gene Alias
-
Gene Description
inhibin, alpha
Omim ID
147380Gene Ontology
HyperlinkGene Summary
The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. [provided by RefSeq
Other Designations
A-inhibin subunit|inhibin alpha subunit
-
Interactome
-
Disease
-
Publication Reference
-
Autoantibody response against NALP5/MATER in primary ovarian insufficiency and in autoimmune Addison's disease.
Brozzetti A, Alimohammadi M, Morelli S, Minarelli V, Hallgren Å, Giordano R, De Bellis A, Perniola R, Kämpe O, Falorni A; Italian Addison Network.
The Journal of Clinical Endocrinology and Metabolism 2015 May; 100(5):1941.
Application:RIA, Human, Serum.
-
Autoantibody response against NALP5/MATER in primary ovarian insufficiency and in autoimmune Addison's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com