HES1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HES1 protein.
Immunogen
HES1 (AAH39152.1, 1 a.a. ~ 277 a.a) full-length human protein.
Sequence
MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HES1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HES1 expression in mouse spleen.Western Blot (Tissue lysate)
HES1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HES1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of HES1 expression in transfected 293T cell line (H00003280-T01) by HES1 MaxPab polyclonal antibody.
Lane 1: HES1 transfected lysate(29.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HES1
Entrez GeneID
3280GeneBank Accession#
BC039152Protein Accession#
AAH39152.1Gene Name
HES1
Gene Alias
FLJ20408, HES-1, HHL, HRY, bHLHb39
Gene Description
hairy and enhancer of split 1, (Drosophila)
Omim ID
139605Gene Ontology
HyperlinkGene Summary
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq
Other Designations
hairy and enhancer of split 1|hairy homolog|transcription factor HES-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com