HPGD monoclonal antibody (M01), clone 1D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HPGD expression in transfected 293T cell line by HPGD monoclonal antibody (M01), clone 1D8.
Lane 1: HPGD transfected lysate(29 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HPGD on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of HPGD transfected lysate using anti-HPGD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HPGD MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HPGD is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant HPGD.
Immunogen
HPGD (AAH18986, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HPGD expression in transfected 293T cell line by HPGD monoclonal antibody (M01), clone 1D8.
Lane 1: HPGD transfected lysate(29 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HPGD on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of HPGD transfected lysate using anti-HPGD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HPGD MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HPGD is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — HPGD
Entrez GeneID
3248GeneBank Accession#
BC018986Protein Accession#
AAH18986Gene Name
HPGD
Gene Alias
15-PGDH, PGDH, PGDH1, SDR36C1
Gene Description
hydroxyprostaglandin dehydrogenase 15-(NAD)
Omim ID
601688Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
15-hydroxy prostaglandin dehydrogenase|15-hydroxyprostaglandin dehydrogenase|NAD+-dependent 15-hydroxyprostaglandin dehydrogenase|short chain dehydrogenase/reductase family 36C, member 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com