HOXA3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HOXA3 partial ORF ( NP_705895, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.21
Interspecies Antigen Sequence
Mouse (90); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HOXA3
Entrez GeneID
3200GeneBank Accession#
NM_153631Protein Accession#
NP_705895Gene Name
HOXA3
Gene Alias
HOX1, HOX1E, MGC10155
Gene Description
homeobox A3
Omim ID
142954Gene Ontology
HyperlinkGene Summary
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Hox-1.5-like protein|homeo box 1E|homeo box A3|homeobox protein HOX-A3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com