HMGB1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HMGB1 full-length ORF ( AAH03378.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.39
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HMGB1
Entrez GeneID
3146GeneBank Accession#
BC003378Protein Accession#
AAH03378.1Gene Name
HMGB1
Gene Alias
DKFZp686A04236, HMG1, HMG3, SBP-1
Gene Description
high-mobility group box 1
Omim ID
163905Gene Ontology
HyperlinkOther Designations
Amphoterin|OTTHUMP00000018199|OTTHUMP00000190860|Sulfoglucuronyl carbohydrate binding protein|high mobility group box 1|high mobility group protein 1|high-mobility group (nonhistone chromosomal) protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Barrier protective functions of hederacolchiside-E against HMGB1-mediated septic responses.
Wonhwa Lee, Hui-Ji Choi, Hyunchae Sim, Samyeol Choo, Gyu Yong Song, Jong-Sup Bae.
Pharmacological Research 2020 Jan; 163:105318.
Application:Func, Human, HUVECs.
-
Inhibitory functions of maslinic acid, a natural triterpene, on HMGB1-mediated septic responses.
Wonhwa Lee, Hayeong Lee, Taeho Lee, Eui Kyun Park, Jong-Sup Bae.
Phytomedicine 2020 Apr; 69:153200.
Application:Func, Human, Human neutrophils, HUVECs.
-
Aloin Reduces HMGB1-Mediated Septic Responses and Improves Survival in Septic Mice by Activation of the SIRT1 and PI3K/Nrf2/HO-1 Signaling Axis.
Yang S, Lee W, Lee BS, Lee C, Park EK, Ku SK, Bae JS.
The American Journal of Chinese Medicine 2019 Apr; 47(3):613.
Application:Func, Human, HUVECs.
-
Suppressive activities of KC1-3 on HMGB1-mediated septic responses.
Lee W, Yuseok O, Lee C, Jeong SY, Lee JH, Baek MC, Song GY, Bae JS.
Biochemical Pharmacology 2019 Feb; 163:260.
Application:Func, Human, HUVECs.
-
Suppressive effects of rare ginsenosides, Rk1 and Rg5, on HMGB1-mediated septic responses.
Kim JE, Lee W, Yang S, Cho SH, Baek MC, Song GY, Bae JS.
Food and Chemical Toxicology 2018 Nov; 124:45.
Application:Func, Human, HUVECs.
-
JH-4 reduces HMGB1-mediated septic responses and improves survival rate in septic mice.
Lee W, Yuseok O, Yang S, Lee BS, Lee JH, Park EK, Baek MC, Song GY, Bae JS.
Journal of Cellular Biochemistry 2019 Apr; 120(4):6277.
Application:Func, Human, HUVECs.
-
Testican-1, as a novel diagnosis of sepsis.
Lee Y, Lee W, Chang HH, Kim SW, Kim J, Bae JS.
Journal of Cellular Biochemistry 2018 May; 119(5):4216.
Application:Func, Human, HUVECs.
-
Sulforaphane Reduces HMGB1-Mediated Septic Responses and Improves Survival Rate in Septic Mice.
Lee IC, Kim DY, Bae JS.
The American Journal of Chinese Medicine 2017 Aug; 45(6):1253.
Application:Func, Human, HUVEC.
-
Zingerone reduces HMGB1-mediated septic responses and improves survival in septic mice.
Lee W, Ku SK, Bae JS.
Toxicology and Applied Pharmacology 2017 Aug; 329:202.
Application:ELISA, Human, HUVEC.
-
Anti-septic effects of pelargonidin on HMGB1-induced responses in vitro and in vivo.
Min G, Ku SK, Park MS, Park TJ, Lee HS, Bae JS.
Archives of Pharmacal Research 2016 Dec; 39(12):1726.
Application:ELISA, Func, IF, WB, Human, HUVEC.
-
IL-1 β/HMGB1 Signaling Promotes the Inflammatory Cytokines Release via TLR S ignaling in Human Intervertebral Disc C ells.
Fang F, Jiang D.
Bioscience Reports 2016 Sep; 36(5):e00379.
Application:Treated, Recombinant protein.
-
Inhibitory Effect of Three Diketopiperazines from Marine-Derived Bacteria on HMGB1-Induced Septic Responses in Vitro and in Vivo.
Lee W, Ku SK, Park S, Kim KM, Choi H, Bae JS.
The American Journal of Chinese Medicine 2016 Sep; 44(6):1145.
Application:Func, Human, HUVEC.
-
Ameliorative effect of a rarely occurring C-methylrotenoid on HMGB1-induced septic responses in vitro and in vivo.
Yang EJ, Lee W, Song KS, Bae JS.
Biochemical Pharmacology 2016 Apr; 110-111:58.
Application:ELISA, Func, Human, HUVEC.
-
Flavanones and Chromones from Salicornia herbacea Mitigate Septic Lethality via Restoring Vascular Barrier Integrity.
Tuan NQ, Lee W, Oh J, Kulkarni RR, Gény C, Jung B, Kang H, Bae JS, Na M.
Journal of Agricultural and Food Chemistry 2015 Nov; 63(46):10121.
Application:ELISA, Human, HUVECs.
-
Methylthiouracil, a new treatment option for sepsis.
Kwak S, Ku SK, Kang H, Baek MC, Bae JS.
Vascular Pharmacology 2017 Jan; 88:1.
Application:Func, Human, HUVECs.
-
Anti-septic effects of phenolic glycosides from Rhododendron brachycarpum in vitro and in vivo.
Yoo H, Ku S-K, Zhou W, Han M-S, Na M, Bae J-S.
Journal of Functional Foods 2015 Jun; 16:448.
Application:ELISA, As a standard.
-
PEGylated lysozymes with anti-septic effects in human endothelial cells and in mice.
Lee W, Park EJ, Kwak S, Kim Y, Na DH, Bae JS.
Biochemical and Biophysical Research Communications 2015 Apr; 459(4):662.
Application:Induction, S-ELISA, Human, Mouse, HUVECs, Serum.
-
Vascular barrier protective effects of baicalin, baicalein and wogonin in vitro and in vivo.
Kwak S, Ku SK, Han MS, Bae JS.
Toxicology and Applied Pharmacology 2014 Nov; 281(1):30.
Application:C-ELISA, Human, Mouse, Cell culture media collected from HUVECs, Serum.
-
Factor Xa inhibits HMGB1-induced septic responses in human umbilical vein endothelial cells and in mice.
Lee W, Ku SK, Bae JS.
Thrombosis and Haemostasis 2014 Oct; 112(4):757.
Application:ELISA, Human, Supernatants from HUVECs culture medium.
-
Expression and regulation of toll-like receptors (TLRs) in human intervertebral disc cells.
Klawitter M, Hakozaki M, Kobayashi H, Krupkova O, Quero L, Ospelt C, Gay S, Hausmann O, Liebscher T, Meier U, Sekiguchi M, Konno SI, Boos N, Ferguson SJ, Wuertz K.
European Spine Journal 2014 Sep; 23(9):1878.
Application:Incubated, Recombinant protein.
-
Ginsenosides Inhibit HMGB1-induced Inflammatory Responses in HUVECs and in Murine Polymicrobial Sepsis.
Wonhwa Lee, Sae-Kwang Ku, Tae Cheon Jeong, Sangkyu Lee, Jong-Sup Bae.
Bulletin of the Korean Chemical Society 2014 Jun; 35(10):2955.
Application:Func, Human, HUVECs.
-
Anti-septic Effects of Pellitorine in HMGB1-Induced Inflammatory Responses In Vitro and In Vivo.
Ku SK, Lee IC, Kim JA, Bae JS.
Inflammation 2014 Apr; 37(2):338.
Application:ELISA, Human, Mouse, HUVECs, Serum.
-
Andrographolide inhibits HMGB1-induced inflammatory responses in HUVECs and in murine polymicrobial sepsis.
Lee W, Ku SK, Yoo H, Song KS, Bae JS.
Acta Physiologica 2014 May; 211(1):176.
Application:ELISA, Human, Mouse, HUVECs, Serum.
-
Vascular barrier protective effects of piperlonguminine in vitro and in vivo.
Ku SK, Kim JA, Bae JS.
Inflammation Research 2014 May; 63(5):369.
Application:C-ELISA, Human, Mouse, HUVECs culture medium, Serum.
-
Anti-septic effects of glyceollins in HMGB1-induced inflammatory responses in vitro and in vivo.
Lee W, Ku SK, Lee YM, Bae JS.
Food and Chemical Toxicology 2014 Jan; 63:1.
Application:ELISA, Human, Mouse, Supernatants collected from HUVECs culture medium, Serum.
-
Barrier protective effects of rosmarinic acid on HMGB1-induced inflammatory responses in vitro and in vivo.
Yang EJ, Ku SK, Lee W, Lee S, Lee T, Song KS, Bae JS.
Journal of Cellular Physiology 2013 May; 228(5):975.
Application:C-ELISA, Human, Mouse, Supernatant from HUVECs culture medium, Serum.
-
Inhibitory effects of epi-sesamin on HMGB1-induced vascular barrier disruptive responses in vitro and in vivo.
Lee W, Ku SK, Kim JA, Lee T, Bae JS.
Toxicology and Applied Pharmacology 2013 Jan; 267(3):201.
Application:ELISA, Func, Human, Mouse, HUVECs, Mouse blood vessels.
-
Emodin-6-O-β-D-glucoside inhibits HMGB1-induced inflammatory responses in vitro and in vivo.
Lee W, Ku SK, Kim TH, Bae JS.
Food and Chemical Toxicology 2013 Feb; 52:97.
Application:Func, Human, HUVECS.
-
Barrier protective effects of rutin in LPS-induced inflammation in vitro and in vivo.
Lee W, Ku SK, Bae JS.
Food and Chemical Toxicology: an International Journal Published for the British Industrial Biologic 2012 Sep; 50(9):3048.
Application:Func, Human, HUVECs.
-
Barrier protective effects of withaferin A in HMGB1-induced inflammatory responses in both cellular and animal models.
Lee W, Kim TH, Ku SK, Min KJ, Lee HS, Kwon TK, Bae JS.
Toxicology and Applied Pharmacology 2012 Jul; 262(1):91.
Application:Func, Human, HUVECs.
-
Vascular barrier protective effects of phlorotannins on HMGB1-mediated proinflammatory responses in vitro and in vivo.
Kim TH, Ku SK, Lee T, Bae JS.
Food and Chemical Toxicology: an International Journal Published for the British Industrial Biologic 2012 Apr; 50(6):2188.
Application:Func, Human, HUVECs.
-
Inhibitory effects of lycopene on HMGB1-mediated pro-inflammatory responses in both cellular and animal models.
Lee W, Ku SK, Bae JW, Bae JS.
Food and Chemical Toxicology: an International Journal Published for the British Industrial Biologic 2012 Jun; 50(6):1826.
Application:Func, Human, HUVECs.
-
Anti-inflammatory activities of oleanolic acid on HMGB1 activated HUVECs.
Yang EJ, Lee W, Ku SK, Song KS, Bae JS.
Food and Chemical Toxicology 2012 May; 50(5):1288.
Application:Cell Culture, Human, Human umbilical vein endothelial cells.
-
Effects of Lower Concentration Thrombin on High-Mobility Group Box 1 Protein-Mediated Inflammatory Responses.
Bae JS.
Inflammation 2012 Jun; 35(3):1078.
Application:Treated, Recombinant protein.
-
Inhibitory effects of kaempferol-3-O-sophoroside on HMGB1-mediated proinflammatory responses.
Kim TH, Ku SK, Bae JS.
Food and Chemical Toxicology 2011 Dec; 50(3-4):1118.
Application:ELISA, Func, Human, HUVEC.
-
Vascular anti-inflammatory effects of curcumin on HMGB1-mediated responses in vitro.
Kim DC, Lee W, Bae JS.
Inflammation Research 2011 Dec; 60(12):1161.
Application:Func, Human, HUVECs.
-
Activated protein C inhibits high mobility group box 1 signaling in endothelial cells.
Bae JS, Rezaie AR.
Blood 2011 Oct; 118(14):3952.
Application:Func, Human, HUVECs.
-
TOX4 and its binding partners recognize DNA adducts generated by platinum anticancer drugs.
Puch CB, Barbier E, Kraut A, Coute Y, Fuchs J, Buhot A, Livache T, Seve M, Favier A, Douki T, Gasparutto D, Sauvaigo S, Breton J.
Archives of Biochemistry and Biophysics 2011 Mar; 507(2):296.
Application:Func, PI, Recombinant protein.
-
The expression of receptor for advanced glycation end products is associated with angiogenesis in human oral squamous cell carcinoma.
Sasahira T, Kirita T, Bhawal UK, Ikeda M, Nagasawa A, Yamamoto K, Kuniyasu H.
Virchows Archiv 2007 Jan; 450(3):287.
Application:Func, Human, HSC-3, HSC-4, MKN45 cells.
-
Colon cancer cell-derived high mobility group 1/amphoterin induces growth inhibition and apoptosis in macrophages.
Kuniyasu H, Yano S, Sasaki T, Sasahira T, Sone S, Ohmori H.
The American Journal of Pathology 2005 Mar; 166(3):751.
Application:Func, Human, PMA-U937 cells and human alveolar macrophages.
-
Barrier protective functions of hederacolchiside-E against HMGB1-mediated septic responses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com