HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HLA-DRB4 protein.
Immunogen
HLA-DRB4 (NP_068818.4, 1 a.a. ~ 266 a.a) full-length human protein.
Sequence
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HLA-DRB4 MaxPab polyclonal antibody. Western Blot analysis of HLA-DRB4 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of HLA-DRB4 expression in transfected 293T cell line (H00003126-T01) by HLA-DRB4 MaxPab polyclonal antibody.
Lane 1: HLA-DRB4 transfected lysate(29.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HLA-DRB4
Entrez GeneID
3126GeneBank Accession#
NM_021983Protein Accession#
NP_068818.4Gene Name
HLA-DRB4
Gene Alias
DRB4, HLA-DR4B
Gene Description
major histocompatibility complex, class II, DR beta 4
Gene Ontology
HyperlinkGene Summary
HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq
Other Designations
DRB1 transplantation antigen|HLA DRB1*1202|MHC HLA DR-beta chain|MHC class II HLA-DR-beta-7|MHC class II antigen HLA-DR-beta|MHC class II antigen HLA-DRB1|MHC class2 antigen|class II histocompatibility antigen HLA DR alpha, beta1-0307|human leucocyte anti
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com