HLA-DQA1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HLA-DQA1 partial ORF ( NP_002113.2, 24 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.31
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HLA-DQA1
Entrez GeneID
3117GeneBank Accession#
NM_002122Protein Accession#
NP_002113.2Gene Name
HLA-DQA1
Gene Alias
CD, CELIAC1, DQ-A1, FLJ27088, FLJ27328, GSE, HLA-DQA, MGC149527
Gene Description
major histocompatibility complex, class II, DQ alpha 1
Gene Ontology
HyperlinkGene Summary
HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq
Other Designations
Gluten-sensitive enteropathy (celiac disease)|MHC HLA-DQ alpha|MHC class II HLA-D alpha glycoprotein|MHC class II HLA-DQ-alpha-1|MHC class II antigen|MHC class II surface glycoprotein|OTTHUMP00000029141|OTTHUMP00000176885|OTTHUMP00000178551|OTTHUMP0000017
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com