HBA1 monoclonal antibody (M02), clone 4F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HBA1 monoclonal antibody (M02), clone 4F9. Western Blot analysis of HBA1 expression in human placenta.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBA1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HBA1.
Immunogen
HBA1 (NP_000549, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HBA1 monoclonal antibody (M02), clone 4F9. Western Blot analysis of HBA1 expression in human placenta.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBA1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — HBA1
Entrez GeneID
3039GeneBank Accession#
NM_000558Protein Accession#
NP_000549Gene Name
HBA1
Gene Alias
HBH, HBA-T3
Gene Description
hemoglobin, alpha 1
Omim ID
141800Gene Ontology
HyperlinkGene Summary
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq
Other Designations
alpha 1 globin|alpha one globin|alpha-1 globin|alpha-1-globin|hemoglobin alpha 1 globin chain|hemoglobin alpha-1 chain
-
Interactome
-
Disease
-
Publication Reference
-
Role of α-Globin H Helix in the Building of Tetrameric Human Hemoglobin: Interaction with α-Hemoglobin Stabilizing Protein (AHSP) and Heme Molecule.
Domingues-Hamdi E, Vasseur C, Fournier JB, Marden MC, Wajcman H, Baudin-Creuza V.
PLoS One 2014 Nov; 9(11):e111395.
Application：WB-Re, Recombinant protein.
-
The differentiating and apoptotic effects of 2-aza-5'-deoxycytidine are dependent on the PU.1 expression level in PU.1-transgenic K562 cells.
Aoyama S, Nakano H, Danbara M, Higashihara M, Harigae H, Takahashi S.
Biochemical and Biophysical Research Communications 2012 Apr; 420(4):775.
Application：WB, Human, K562 cells.
-
Role of α-Globin H Helix in the Building of Tetrameric Human Hemoglobin: Interaction with α-Hemoglobin Stabilizing Protein (AHSP) and Heme Molecule.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com