GRB7 monoclonal antibody (M03), clone 3C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GRB7 expression in transfected 293T cell line by GRB7 monoclonal antibody (M03), clone 3C12.
Lane 1: GRB7 transfected lysate(59.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of GRB7 transfected lysate using anti-GRB7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GRB7 MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GRB7.
Immunogen
GRB7 (AAH06535, 37 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Isotype
IgG2b Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GRB7 expression in transfected 293T cell line by GRB7 monoclonal antibody (M03), clone 3C12.
Lane 1: GRB7 transfected lysate(59.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of GRB7 transfected lysate using anti-GRB7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GRB7 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — GRB7
Entrez GeneID
2886GeneBank Accession#
BC006535Protein Accession#
AAH06535Gene Name
GRB7
Gene Alias
-
Gene Description
growth factor receptor-bound protein 7
Omim ID
601522Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Alternative splicing results in multiple transcript variants encoding different isoforms, although the full-length natures of only two of the variants have been determined to date. [provided by RefSeq
Other Designations
OTTHUMP00000164352
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com