SFN monoclonal antibody (M01), clone 3C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SFN monoclonal antibody (M01), clone 3C3 Western Blot analysis of SFN expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of SFN expression in transfected 293T cell line by SFN monoclonal antibody (M01), clone 3C3.
Lane 1: SFN transfected lysate(27.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SFN on formalin-fixed paraffin-embedded human uterine cervix tissue. [antibody concentration 5 ug/ml]
Immunoprecipitation
Immunoprecipitation of SFN transfected lysate using anti-SFN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SFN MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (53.02 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SFN.
Immunogen
SFN (AAH00329.1, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (53.02 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SFN monoclonal antibody (M01), clone 3C3 Western Blot analysis of SFN expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SFN expression in transfected 293T cell line by SFN monoclonal antibody (M01), clone 3C3.
Lane 1: SFN transfected lysate(27.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SFN on formalin-fixed paraffin-embedded human uterine cervix tissue. [antibody concentration 5 ug/ml]Immunoprecipitation
Immunoprecipitation of SFN transfected lysate using anti-SFN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SFN MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — SFN
Entrez GeneID
2810GeneBank Accession#
BC000329Protein Accession#
AAH00329.1Gene Name
SFN
Gene Alias
YWHAS
Gene Description
stratifin
Omim ID
601290Gene Ontology
HyperlinkOther Designations
14-3-3 sigma|OTTHUMP00000004242
-
Interactome
-
Pathway
-
Publication Reference
-
An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells.
Sousa MM, Zub KA, Aas PA, Hanssen-Bauer A, Demirovic A, Sarno A, Tian E, Liabakk NB, Slupphaug G.
PLoS One 2013 Feb; 8(2):e55493.
Application：WB, Human, 8226 cells,8226-LR5 cells.
-
An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com