GOT2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GOT2.
Immunogen
GOT2 (NP_002071, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Sequence
LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GOT2 polyclonal antibody (A01), Lot # FHC0061120QCS1 Western Blot analysis of GOT2 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
GOT2 polyclonal antibody (A01), Lot # FHC0061120QCS1. Western Blot analysis of GOT2 expression in PC-12.Western Blot (Cell lysate)
GOT2 polyclonal antibody (A01), Lot # FHC0061120QCS1. Western Blot analysis of GOT2 expression in Raw 264.7.Western Blot (Cell lysate)
GOT2 polyclonal antibody (A01), Lot # FHC0061120QCS1. Western Blot analysis of GOT2 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — GOT2
Entrez GeneID
2806GeneBank Accession#
NM_002080Protein Accession#
NP_002071Gene Name
GOT2
Gene Alias
FLJ40994, KAT4, KATIV, mitAAT
Gene Description
glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Omim ID
138150Gene Ontology
HyperlinkGene Summary
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq
Other Designations
aspartate aminotransferase 2|kynurenine aminotransferase IV
-
Interactome
-
Pathway
- Alanine
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Cysteine and methionine metabolism
- Isoquinoline alkaloid biosynthesis
- Metabolic pathways
+ View More Disease
-
Publication Reference
-
Food and Chemical Toxicology, 2011, 'Possible role of cysteine-S-conjugate ?]-lyase in species differences in cisplatin nephrotoxicity', R. Katayama, S. Nagata, H. Iida, N. Yamagishi, T. Yamashita, K. Furuhama.
Cooper AJ, Hanigan MH.
Food and Chemical Toxicology 2011 Dec; 49(12):3279.
Application:WB-Ti, Mammalian species, Kidneys.
-
N-terminal mutant huntingtin associates with mitochondria and impairs mitochondrial trafficking.
Orr AL, Li S, Wang CE, Li H, Wang J, Rong J, Xu X, Mastroberardino PG, Greenamyre JT, Li XJ.
Journal of Neuroscience 2008 Mar; 28(11):2783.
Application:WB, Mouse, Mouse brain mitochondria.
-
Food and Chemical Toxicology, 2011, 'Possible role of cysteine-S-conjugate ?]-lyase in species differences in cisplatin nephrotoxicity', R. Katayama, S. Nagata, H. Iida, N. Yamagishi, T. Yamashita, K. Furuhama.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com