GNAQ monoclonal antibody (M04), clone 3B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GNAQ.
Immunogen
GNAQ (NP_002063.2, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVI
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GNAQ monoclonal antibody (M04), clone 3B9. Western Blot analysis of GNAQ expression in PC-12.Western Blot (Cell lysate)
GNAQ monoclonal antibody (M04), clone 3B9. Western Blot analysis of GNAQ expression in Raw 264.7.Western Blot (Cell lysate)
GNAQ monoclonal antibody (M04), clone 3B9. Western Blot analysis of GNAQ expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GNAQ is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — GNAQ
Entrez GeneID
2776GeneBank Accession#
NM_002072Protein Accession#
NP_002063.2Gene Name
GNAQ
Gene Alias
G-ALPHA-q, GAQ
Gene Description
guanine nucleotide binding protein (G protein), q polypeptide
Omim ID
600998Gene Ontology
HyperlinkGene Summary
Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta (MIM 600230).[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Protein kinase C ζ interacts with a novel binding region of Gαq to act as functional effector protein.
Sanchez-Fernandez G, Cabezudo S, Caballero A, Garcia-Hoz C, Tall GG, Klett J, Michnick SW, Mayor F Jr, Ribas C.
The Journal of Biological Chemistry 2016 Apr; 291(18):9513.
Application:WB-Ce, Human, CHO, HeLa, COS-7, HEK293 cells.
-
Protein kinase C ζ interacts with a novel binding region of Gαq to act as functional effector protein.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com