GLUL monoclonal antibody (M02), clone 3B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GLUL.
Immunogen
GLUL (NP_002056, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.
Lane 1: GLUL transfected lysate(42.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GLUL is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GLUL
Entrez GeneID
2752GeneBank Accession#
NM_002065Protein Accession#
NP_002056Gene Name
GLUL
Gene Alias
GLNS, GS, PIG43, PIG59
Gene Description
glutamate-ammonia ligase (glutamine synthetase)
Gene Ontology
HyperlinkGene Summary
Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]).[supplied by OMIM
Other Designations
OTTHUMP00000035524|OTTHUMP00000035525|cell proliferation-inducing protein 59|glutamate-ammonia ligase (glutamine synthase)|glutamine synthetase|proliferation-inducing protein 43
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol.
Herbert MK, Kuiperij HB, Verbeek MM.
Journal of Immunology 2012 Jul; 381(1-2):1.
Application:ELISA, Human, Human cerebrospinal fluid .
-
Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com