GAPDH polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GAPDH.
Immunogen
GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag.
Sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — GAPDH
Entrez GeneID
2597GeneBank Accession#
NM_002046Protein Accession#
NP_002037Gene Name
GAPDH
Gene Alias
G3PD, GAPD, MGC88685
Gene Description
glyceraldehyde-3-phosphate dehydrogenase
Omim ID
138400Gene Ontology
HyperlinkGene Summary
The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq
Other Designations
OTTHUMP00000174431|OTTHUMP00000174432|aging-associated gene 9 protein|glyceraldehyde 3-phosphate dehydrogenase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
-
Disease
-
Publication Reference
-
Overexpressed Gα13 activates serum response factor through stoichiometric imbalance with Gβγ and mislocalization to the cytoplasm.
Sharmin Hasan, Nicholas F White, Alicia C Tagliatela, R Taylor Durall, Katherine M Brown, Gray R McDiarmid, Thomas E Meigs.
Cellular Signalling 2023 Feb; 102:110534.
Application:WB-Tr, Human, HEK293 cells.
-
Cyclic compression-induced p38 activation and subsequent MMP13 expression requires Rho/ROCK activity in bovine cartilage explants.
Nakagawa K, Teramura T, Takehara T, Onodera Y, Hamanishi C, Akagi M, Fukuda K.
Inflammation Research 2012 Oct; 61(10):1093.
Application:WB, Bovine, Bovine cartilage explants, Primary chondrocytes.
-
Overexpressed Gα13 activates serum response factor through stoichiometric imbalance with Gβγ and mislocalization to the cytoplasm.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com