FKBP5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FKBP5 full-length ORF ( AAH42605, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
76.01
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FKBP5
Entrez GeneID
2289GeneBank Accession#
BC042605Protein Accession#
AAH42605Gene Name
FKBP5
Gene Alias
FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10
Gene Description
FK506 binding protein 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq
Other Designations
51 kDa FK506-binding protein 5|54 kDa progesterone receptor-associated immunophilin|FF1 antigen|FK506-binding protein 5|HSP90-binding immunophilin|OTTHUMP00000016268|T-cell FK506-binding protein|peptidylprolyl cis-trans isomerase|rotamase
-
Interactome
-
Disease
-
Publication Reference
-
Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agent.
Horibe T, Kohno M, Haramoto M, Ohara K, Kawakami K.
Journal of Translational Medicine 2011 Jan; 9:8.
Application:Func, PI, Recombinant protein.
-
Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agent.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com