FGL1 monoclonal antibody (M01), clone 2A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FGL1.
Immunogen
FGL1 (AAH07047.1, 19 a.a. ~ 312 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGL1 expression in transfected 293T cell line by FGL1 monoclonal antibody (M01), clone 2A4.
Lane 1: FGL1 transfected lysate(36.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of FGL1 transfected lysate using anti-FGL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGL1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGL1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — FGL1
Entrez GeneID
2267GeneBank Accession#
BC007047Protein Accession#
AAH07047.1Gene Name
FGL1
Gene Alias
HFREP1, HP-041, LFIRE1, MGC12455
Gene Description
fibrinogen-like 1
Omim ID
605776Gene Ontology
HyperlinkGene Summary
Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000122468|hepassocin|hepatocellular carcinoma-related sequence|hepatocyte-derived fibrinogen-related protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com