FGF11 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FGF11 partial ORF ( NP_004103, 15 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FGF11
Entrez GeneID
2256GeneBank Accession#
NM_004112Protein Accession#
NP_004103Gene Name
FGF11
Gene Alias
FHF3, FLJ16061, MGC102953, MGC45269
Gene Description
fibroblast growth factor 11
Omim ID
601514Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development. [provided by RefSeq
Other Designations
fibroblast growth factor homologous factor 3
-
Interactome
-
Pathway
-
Publication Reference
-
Fibroblast Growth Factor-10 Promotes Cardiomyocyte Differentiation from Embryonic and Induced Pluripotent Stem Cells.
Chan SS, Li HJ, Hsueh YC, Lee DS, Chen JH, Hwang SM, Chen CY, Shih E, Hsieh PC.
PLoS One 2010 Dec; 5(12):e14414.
Application:Func, Mouse, Cardiomyocytes, Embryonic stem cells.
-
Fibroblast Growth Factor-10 Promotes Cardiomyocyte Differentiation from Embryonic and Induced Pluripotent Stem Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com