ENO3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ENO3 partial ORF ( NP_001967, 228 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.24
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ENO3
Entrez GeneID
2027GeneBank Accession#
NM_001976Protein Accession#
NP_001967Gene Name
ENO3
Gene Alias
MSE
Gene Description
enolase 3 (beta, muscle)
Omim ID
131370Gene Ontology
HyperlinkGene Summary
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR. [provided by RefSeq
Other Designations
2-phospho-D-glycerate hydrolyase|ENO3, muscle enolase 3 beta|OTTHUMP00000125242|beta enolase|enolase 3|enolase-3, beta, muscle|muscle specific enolase|skeletal muscle enolase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com