EIF4G1 monoclonal antibody (M10), clone 2A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
Immunogen
EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EIF4G1 monoclonal antibody (M10), clone 2A9 Western Blot analysis of EIF4G1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
EIF4G1 monoclonal antibody (M10), clone 2A9. Western Blot analysis of EIF4G1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
EIF4G1 monoclonal antibody (M10), clone 2A9. Western Blot analysis of EIF4G1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EIF4G1 expression in transfected 293T cell line by EIF4G1 monoclonal antibody (M10), clone 2A9.
Lane 1: EIF4G1 transfected lysate(70.95 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF4G1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EIF4G1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EIF4G1
Entrez GeneID
1981GeneBank Accession#
NM_182917Protein Accession#
NP_886553Gene Name
EIF4G1
Gene Alias
DKFZp686A1451, EIF4F, EIF4G, p220
Gene Description
eukaryotic translation initiation factor 4 gamma, 1
Omim ID
600495Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. Alternative splicing results in five transcript variants encoding four distinct isoforms. [provided by RefSeq
Other Designations
EIF4-gamma
-
Interactome
-
Publication Reference
-
Remodeling of the ribosomal quality control and integrated stress response by viral ubiquitin deconjugases.
Jiangnan Liu, Noemi Nagy, Carlos Ayala-Torres, Francisco Aguilar-Alonso, Francisco Morais-Esteves, Shanshan Xu, Maria G Masucci.
Nature Communications 2023 Dec; 14(1):8315.
Application:Co-IP, Human, HEK293T cells.
-
Remodeling of the ribosomal quality control and integrated stress response by viral ubiquitin deconjugases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com