EEF1A2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in human thyroid(diffuse hyperplasia).
Western Blot (Cell lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb Western Blot analysis of EEF1A2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in PC-12.
Western Blot (Cell lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in NIH/3T3.
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
Immunogen
EEF1A2 (NP_001949, 364 a.a. ~ 462 a.a) partial recombinant protein with GST tag.
Sequence
HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in human thyroid(diffuse hyperplasia).Western Blot (Cell lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb Western Blot analysis of EEF1A2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in PC-12.Western Blot (Cell lysate)
EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — EEF1A2
Entrez GeneID
1917GeneBank Accession#
NM_001958Protein Accession#
NP_001949Gene Name
EEF1A2
Gene Alias
EEF1AL, EF-1-alpha-2, EF1A, FLJ41696, HS1, STN, STNL
Gene Description
eukaryotic translation elongation factor 1 alpha 2
Omim ID
602959Gene Ontology
HyperlinkGene Summary
This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000031776|elongation factor 1-alpha 2|elongation factor-1 alpha|statin S1|statin-like
-
Interactome
-
Publication Reference
-
A rapid and specific method to simultaneously quantify eukaryotic elongation factor 1A1 and A2 protein levels in cancer cells.
Bosutti A, Kalaja O, Zanconati F, Dapas B, Grassi G, Passamonti S, Scaggiante B.
Journal of Pharmaceutical and Biomedical Analysis 2019 Nov; 176:112814.
Application：IF, IHC-P, WB, Human, LoVo109, LoVoDX cells, Pancreas specimen, PC-3, PZHPV-7 cells.
-
METTL13 Methylation of eEF1A Increases Translational Output to Promote Tumorigenesis.
Liu S, Hausmann S, Carlson SM, Fuentes ME, Francis JW, Pillai R, Lofgren SM, Hulea L, Tandoc K, Lu J, Li A, Nguyen ND, Caporicci M, Kim MP, Maitra A, Wang H, Wistuba II, Porco JA Jr, Bassik MC, Elias JE, Song J, Topisirovic I, Van Rechem C, Mazur PK, Gozani O.
Cell 2019 Jan; 176(3):491.
Application：WB, Human, T3M4 cells.
-
Degradation of newly synthesized polypeptides by ribosome-associated RACK1/JNK/eEF1A2 complex.
Gandin V, Gutierrez GJ, Brill LM, Varsano T, Feng Y, Aza-Blanc P, Au Q, McLaughlan S, Ferreira TA, Alain T, Sonenberg N, Topisirovic I, Ronai ZA.
Molecular and Cellular Biology 2013 Jul; 33(13):2510.
Application：WB, Human, HEK 293T cells.
-
Dissecting the expression of EEF1A1/2 genes in human prostate cancer cells: the potential of EEF1A2 as a hallmark for prostate transformation and progression.
Scaggiante B, Dapas B, Bonin S, Grassi M, Zennaro C, Farra R, Cristiano L, Siracusano S, Zanconati F, Giansante C, Grassi G.
British Journal of Cancer 2012 Jan; 106(1):166.
Application：WB, Human, DU-145, PC-3, LNCaP, PZHPV-7 cells.
-
A rapid and specific method to simultaneously quantify eukaryotic elongation factor 1A1 and A2 protein levels in cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com