ARID3A monoclonal antibody (M01), clone 1A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARID3A.
Immunogen
ARID3A (NP_005215, 317 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARID3A monoclonal antibody (M01), clone 1A11 Western Blot analysis of ARID3A expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARID3A is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi ( Cat # H00001820-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody (M01), clone 1A11 (Cat # H00001820-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ARID3A
Entrez GeneID
1820GeneBank Accession#
NM_005224Protein Accession#
NP_005215Gene Name
ARID3A
Gene Alias
BRIGHT, DRIL1, DRIL3, E2FBP1
Gene Description
AT rich interactive domain 3A (BRIGHT-like)
Omim ID
603265Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq
Other Designations
ARID domain-containing 3A|AT rich interactive domain 3A (BRIGHT- like)|AT rich interactive domain 3A (BRIGHT- like) protein|B-cell regulator of IgH transcription|E2F-binding protein 1|dead ringer-like 1
-
Interactome
-
Disease
-
Publication Reference
-
Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry.
Kang UB, Yeom J, Kim HJ, Kim H, Lee C.
Journal of Proteomics 2012 Jun; 75(10):3050.
Application:WB, Human, CRC tissues.
-
Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com