DPP6 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DPP6 full-length ORF (1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MELAALGLSPCPRLLHAELLPGLLTVFSLRFLQDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQVQYACYSVLNLEQDIPFMEKDLTGVQGLLLQQTRLCCGGRC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.5
Interspecies Antigen Sequence
Mouse (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DPP6
Entrez GeneID
1804GeneBank Accession#
AK126619.1Gene Name
DPP6
Gene Alias
DPPX, MGC46605
Gene Description
dipeptidyl-peptidase 6
Omim ID
126141Gene Ontology
HyperlinkGene Summary
This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
dipeptidyl aminopeptidase IV-related protein|dipeptidyl aminopeptidase-like protein 6|dipeptidyl peptidase IV-related protein|dipeptidylpeptidase 6|dipeptidylpeptidase VI
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com