DPH2 monoclonal antibody (M02), clone 5B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DPH2.
Immunogen
DPH2 (NP_001375, 125 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DPH2 monoclonal antibody (M02), clone 5B10 Western Blot analysis of DPH2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DPH2 monoclonal antibody (M02), clone 5B10. Western Blot analysis of DPH2 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DPH2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DPH2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DPH2
Entrez GeneID
1802GeneBank Accession#
NM_001384Protein Accession#
NP_001375Gene Name
DPH2
Gene Alias
DPH2L2
Gene Description
DPH2 homolog (S. cerevisiae)
Omim ID
603456Gene Ontology
HyperlinkGene Summary
This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DPH2-like 2|OTTHUMP00000010007|diphthamide biosynthesis protein 2|diphthamide biosynthesis-like protein 2|diptheria toxin resistance protein required for diphthamide biosynthesis-like 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com