DYNC1H1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DYNC1H1 full-length ORF ( AAH64521.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DYNC1H1
Entrez GeneID
1778GeneBank Accession#
BC064521.1Protein Accession#
AAH64521.1Gene Name
DYNC1H1
Gene Alias
DHC1, DHC1a, DKFZp686P2245, DNCH1, DNCL, DNECL, DYHC, Dnchc1, HL-3, KIAA0325, p22
Gene Description
dynein, cytoplasmic 1, heavy chain 1
Omim ID
600112Gene Ontology
HyperlinkGene Summary
Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq
Other Designations
cytoplasmic dynein 1 heavy chain 1|dynein heavy chain, cytosolic|dynein, cytoplasmic, heavy polypeptide 1|dynein, cytoplasmic-like
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com