DKC1 (Human) Recombinant Protein (Q01)

Catalog # H00001736-Q01

Size

Price

Stock

Quantity

Size:25 ug
Price: USD $ 510.00
Stock:
order now, ship next day
abnova-minus
abnova-plus
Size:10 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
QC Test

  • Specification

    Product Description

    Human DKC1 partial ORF ( AAH09928, 321 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.

    Sequence

    LRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYS

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    36.63

    Interspecies Antigen Sequence

    Mouse (96); Rat (88)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — DKC1

    Entrez GeneID

    1736

    GeneBank Accession#

    BC009928

    Protein Accession#

    AAH09928

    Gene Name

    DKC1

    Gene Alias

    CBF5, DKC, FLJ97620, NAP57, NOLA4, XAP101

    Gene Description

    dyskeratosis congenita 1, dyskerin

    Omim ID

    300126 300240 305000

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the NOLA1, 2 and 3 proteins. The protein encoded by this gene and the three NOLA proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The protein encoded by this gene is related to the Saccharomyces cerevisiae Cbf5p and Drosophila melanogaster Nop60B proteins. The gene lies in a tail-to-tail orientation with the palmitoylated erythrocyte membrane protein gene and is transcribed in a telomere to centromere direction. Both nucleotide substitutions and single trinucleotide repeat polymorphisms have been found in this gene. Mutations in this gene cause X-linked dyskeratosis congenita, a disease resulting in reticulate skin pigmentation, mucosal leukoplakia, nail dystrophy, and progressive bone marrow failure in most cases. Mutations in this gene also cause Hoyeraal-Hreidarsson syndrome, which is a more severe form of dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    H/ACA ribonucleoprotein complex subunit 4|OTTHUMP00000026046|cbf5p homolog|dyskerin|nopp140-associated protein of 57 kDa|nucleolar protein family A member 4|snoRNP protein DKC1

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All