DDOST monoclonal antibody (M06), clone 2D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in human stomach.
Western Blot (Cell lysate)
DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in COLO 320 HSR.
Western Blot (Cell lysate)
DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in HepG2.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDOST is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DDOST on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDOST.
Immunogen
DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in human stomach.Western Blot (Cell lysate)
DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in COLO 320 HSR.Western Blot (Cell lysate)
DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in HepG2.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDOST is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DDOST on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DDOST
Entrez GeneID
1650GeneBank Accession#
NM_005216Protein Accession#
NP_005207Gene Name
DDOST
Gene Alias
AGE-R1, KIAA0115, MGC2191, OK/SW-cl.45, OST, OST48, WBP1
Gene Description
dolichyl-diphosphooligosaccharide-protein glycosyltransferase
Omim ID
602202Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia. [provided by RefSeq
Other Designations
OTTHUMP00000002882|advanced glycation endproduct receptor 1|dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit|dolichyl-diphosphooligosaccharide-protein glycotransferase|oligosaccharyltransferase 48 kDa subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com